PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000779.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 312aa    MW: 34650 Da    PI: 8.263
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000779.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.51.3e-3285141259
              ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              + vrY+eClkNhAas+Gg+a+DGCgEfmps geeg+ +al+C+AC+CHRnFHR+eve 
  Itr_sc000779.1_g00003.1  85 KMVRYRECLKNHAASMGGNATDGCGEFMPS-GEEGSLEALTCSACNCHRNFHRKEVEG 141
                              679**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.8E-2987139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-2687142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-3188139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.57689138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.2E-30219295IPR009057Homeodomain-like
SuperFamilySSF466896.81E-18226294IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-26233289IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEIPSSHEDG EMPIPINSTY GHGQHMIMHH HEPPTHNHNH NNNHIIIPPS SNGPPIADHP  60
PAAAYNNNNN NNNSQSQLVI TSSKKMVRYR ECLKNHAASM GGNATDGCGE FMPSGEEGSL  120
EALTCSACNC HRNFHRKEVE GEPLPPPLSL PCDCYHHNTI KRKVFVGHHK ALPGPEPPLG  180
GGGGGGYPRA AAAAAAAAVP HQMIMSYNMA TLLQPSESDE HEEQRPSHQL MVKKRFRTKF  240
TQEQKDKMLS FAERVGWKIQ KQEESVVQQF CQEVGVKRRV LKVWMHNNKH NLAKKTNNPN  300
PNPNPNPPQI QL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-252342911875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007023152.11e-111Homeobox protein 31
SwissprotQ9M9S07e-79ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A061GFH01e-110A0A061GFH0_THECC; Homeobox protein 31
STRINGPGSC0003DMT4000533971e-106(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-74homeobox protein 31